STUDresearch · Peptide

PNC-27

Also known as

PNC27 · PNC 27 · p53-HDM-2 membrane peptide (discussion label) · chimeric p53-penetratin peptide · p53 residues 12–26 + MRP / penetratin peptide · OM-301 (Oncolyze lead candidate; previously discussed as PNC-27 lineage) · HY-P3508 (catalog-style ID on some lab suppliers)

Community talk. May be wrong. Not medical advice. Not a protocol. Not for human or animal use.

Open in the directory ↗
Peptide Niche talk Systemic SubQ / IV / Intratumoral Experimental oncology-adjacent peptides

Whole-body exposure is discussed; intratumoral reports focus on local concentration.

What people say PNC-27 is an experimental p53-derived penetratin fusion peptide studied for membrane-HDM2 binding and pore-mediated cancer-cell killing. Its evidence base is preclinical; it is not an approved cancer treatment. Doses people talk about
One self-experiment without known cancer500 mcg nightly; later 1 mg nightly

Twelve weeks was a plan, not completed follow-up. Around week three the author called early sensations likely placebo; a later reply reported normal bloodwork and no adverse events. Route was unstated, and self-reported labs do not establish safety.

In-vitro working concentration50 μg/mL

A culture exposure used in rapid-kill work; not an injectable dose.

AML mouse study~40 mg/kg IP daily

A roughly two-to-three-week engineered-mouse regimen; no validated human conversion follows from it.

Pancreatic-model pump total~1 mg over ~14 days

A continuous preclinical delivery total, not a per-dose or human amount.

No authoritative human dose exists. Community, in-vitro and animal amounts are descriptive evidence only and must not be converted into a treatment plan.

Half-life & effect duration

Half-life in the body
  • Secondary / community estimateAbout 30 minutes
  • Other secondary estimateAbout 2–4 hours
Felt duration people report
  • One accountEarly sensations later judged likely placebo; no adverse events reported in its follow-up
  • Other accountsBlood-count concerns or a local allergic reaction lasting several days
Timing context & sources
How it may feel Reports are mixed and deeply confounded: one 500 mcg nightly user called early sensations likely placebo around week three and later reported 1 mg nightly with normal bloodwork and no adverse events. A caregiver reported no success in late-stage glioblastoma despite nasal/SubQ use; another user reported no tumor change after four weeks, with low blood counts delaying radiation. A fourth described a local allergic reaction after changing both amount and vial.

Tap a line to jump into the full notes. Research only — may be wrong.

Timing context & sources

Half-life in the body

A robust measured human PNC-27 parent-peptide half-life was not located.

Published minutes-to-hours observations concern pore formation and cell death in laboratory models, while community schedules and continuous pumps concern dosing design.

Pharmacodynamic kill time, a copied administration interval and a secondary half-life estimate cannot establish human parent-peptide clearance.

  • PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis (opens in a new tab)Primary research article: Abstract; experimental methods and results on HDM-2 binding, electron microscopy and cell lysis. Full text inspected through Europe PMC XML because PMC presented a verification interstitial: https://www.ebi.ac.uk/europepmc/webservices/rest/PMC9138867/fullTextXML .Primary laboratory/model evidence; not a measured human pharmacokinetic study, controlled clinical outcome trial or self-use dosing source. The methods include a 150 µg/mL microscopy exposure; this source does not independently identify every inherited 50 µg/mL experiment.
  • PNC-27 Experiment (opens in a new tab)osvaldo_wes opening/day-one report lines 21–27, approximately three-week reply lines 66–69 and later 1 mg nightly/lab reply lines 179–184; caregiver SubQ/nasal and co-treatment report lines 78–104; Appropriate-Sport452 radiation-delay comment lines 115–123; Xlajdak reaction lines 193–195.Unverified products and identities, no controls, mixed routes and amounts, severe disease, radiation, dexamethasone, antibiotics and multi-peptide use; includes speculative mechanisms and preparation detail not reproduced in the reader summary.

Felt duration people report

The inspected reports do not establish a dependable PNC-27 felt duration.

One author judged early sensations likely placebo around three weeks and later reported 1 mg nightly with normal bloodwork and no adverse events. Other reports included reported blood-count decline that delayed radiation and a multi-day local allergic reaction after changing both amount and vial; no causal timing conclusion follows.

Unverified identity, severe underlying disease, concurrent treatments, no controls and within-person changes prevent causal or population timing inference.

  • PNC-27 Experiment (opens in a new tab)osvaldo_wes opening/day-one report lines 21–27, approximately three-week reply lines 66–69 and later 1 mg nightly/lab reply lines 179–184; caregiver SubQ/nasal and co-treatment report lines 78–104; Appropriate-Sport452 radiation-delay comment lines 115–123; Xlajdak reaction lines 193–195.Unverified products and identities, no controls, mixed routes and amounts, severe disease, radiation, dexamethasone, antibiotics and multi-peptide use; includes speculative mechanisms and preparation detail not reproduced in the reader summary.
  • Questions and Answers: FDA alerts companies to stop the illegal sale of products claiming to treat cancer (opens in a new tab)Consumer-risk discussion lines 81–95, especially PNC-27 contamination and unapproved-cancer-product statement at line 84.Regulatory safety notice, not a pharmacokinetic, efficacy or dose-ranging study; it addresses an unapproved marketed sample and health-fraud context.

What people say 15

  • Anecdotes sparse: Social/patient-group posts asking “has anyone tried it” exist; controlled human outcome data do not. Many posts clash with the FDA warning era. anecdote
  • Honest ceiling: No established human response rate, survival benefit, or standardized imaging response package for research-chemical self-use. forum
  • Lab kill (broad): Dose-related cytotoxicity reported across many solid lines (breast, pancreas, colon, ovary, lung, cervix, melanoma, sarcoma-type lines in the literature set) via membrane disruption when HDM-2 is membrane-associated. lab
  • Speed of kill: High kill fractions often within minutes to ~4 hours in published setups; example catalog-cited MIA-PaCa-2 work: ~50 μg/mL drove ~100% cell death by ~90 minutes with LDH-style readouts in some reports. lab
  • IC50 band: Review-style summaries put IC50s roughly in the ~6–80 μM range across lines; cervical lines have been reported among the lower end (~7–17 μM); some breast/pancreatic lines discussed near ~33 μM; one older pancreatic IC50 figure of ~125 μg/mL also appears in ex vivo write-ups — units and assay conditions matter. lab
  • Near-complete kill thresholds: Some dose-response work reports ~100% tumor-cell killing above ~100 μg/mL by LDH release at 37 °C; cervical experiments have used curves up to hundreds of μg/mL with max test points near ~20 μM / ~80 μg/mL on normal cervical epithelium showing sparing. lab
  • Ovarian / primary ex vivo: Cytotoxicity reported on fresh patient-derived and chemo-context ovarian cancer cells; complete kill of some primary ovarian cultures at ~60 μM after ~4 h has been described, with control peptide PNC-29 inactive. lab
  • Leukemia / AML models: p53-independent necrotic kill in K562 and multiple AML-related lines; membrane HDM-2 co-localization; LSC-enriched populations and secondary-transplant survival benefits discussed in later AML mouse work. trial
  • Animal solid tumors: Preclinical write-ups claim growth block, metastasis prevention, or eradication-type outcomes (e.g., osmotic-pump continuous peptide delivery against pancreatic xenotransplants) — designs, total mg, and controls vary by paper. animal
  • Pump total-dose example (related literature): Continuous delivery on the order of ~1 mg peptide over ~14 days via mini-osmotic pump has been cited for pancreatic models with strong local/systemic preclinical effect claims; related PNC-28 work used multi-mg/mouse pump totals (1 / 10 / 20 mg over 14 days) with higher totals more active. animal
  • Normal-cell sparing narrative: Untransformed controls and normal HSC differentiation often unaffected at cancer-killing concentrations in the same papers — the main marketing hook; does not equal multi-route human safety. lab
  • Metabolic adjunct lab note: Lithium acetoacetate / acetoacetate co-incubation has been reported to sensitize some cervical (and related) lines to PNC-27 in vitro — lab synergy, not a community “keto stack protocol.” lab
  • PNC-28 companion story: Shorter analog (p53 residues 17–26 + same penetratin) shares the membrane-pore oncology narrative; sometimes less potent in head-to-heads because of the shorter HDM-2 contact segment. trial
  • AML mouse IP regimen (cited): ~40 mg/kg intraperitoneal once daily for ~2–3 weeks reduced engraftment and prolonged survival vs vehicle/control peptide framing in Mll/Flt3-type AML mouse models (Wang et al. / supplier datasheet summaries). animal
  • Cancer stem / resistant framing: CD44+ colon stem-like populations, chemo-surviving ovarian cells, and AML LSC-type targets are repeatedly discussed as sensitive in specialized papers; paclitaxel combination synergy has been explored in ovarian research contexts. lab

Doses people talk about 11

  • No authoritative human dose: Multiple research-protocol pages themselves state no validated human dose exists; figures above a few hundred micrograms/day on SC wellness charts are openly speculative. forum
  • Mid-range content-site talk: Some peptide-education pages discuss starting near ~1 mg SC and stepping toward ~1.5–2 mg based on “protocol” — again unvalidated and inconsistent with both mouse mg/kg IP and the conservative mcg charts. forum
  • Route-dose coupling: Intratumoral discussion aims to concentrate exposure at a lesion; IV/IP maximize systemic Cmax for disseminated disease models; SC is mostly research-chemical convenience and may not match published IP exposure. forum
  • Do not mix chart math: Never blend a 40 mg/kg mouse IP figure, a 0.1–1 mg/kg IV blog figure, and a 100–500 mcg SC chart into one “protocol” — they are different contexts and largely non-transferable. forum
  • Warned commercial forms: FDA noted products sold as nebulized solution, IV solution, vaginal suppository, or rectal suppository marketed for cancer — none are approved therapies; contamination risk was part of the warning. forum
  • Identity/purity: Without orthogonal ID (HPLC/MS) and sterility testing, labeled mg may not equal delivered peptide; oncology self-use multiplies infection and under/over-dose risk. forum
  • In-vitro working concentrations: Common experimental bands span low-µM IC50s through tens–hundreds of µg/mL (e.g., 50 μg/mL time-course kill; >100 μg/mL near-complete LDH kill in some setups; curves 0–500 μg/mL in cervical work). These are culture exposures, not inject math. lab
  • Osmotic-pump totals (preclinical): ~1 mg continuous over ~14 days appears in pancreatic xenotransplant discussion for strong effect claims; related PNC-28 pump studies escalated to 10–20 mg/mouse over 14 days under stringent conditions. animal
  • Framing: Everything below is discussed dose culture or preclinical math — not FDA regimens, not safety-validated self-treatment, not medical advice. Vendor charts contradict each other by orders of magnitude. forum
  • Bodyweight IV-style secondary talk: Some peptide encyclopedias and secondary sites repeat ~0.1–1 mg/kg daily intravenous-style dosing “over several weeks” for research/clinical-study framing — not an approved label and poorly sourced to modern RCTs. forum
  • AML mouse (IP): ~40 mg/kg intraperitoneal once daily for ~2–3 weeks is a concrete published/supplier-cited anti-leukemia regimen in engineered AML mice — allometric jumps to humans are not validated. animal

How it may feel 8

  • No performance curve: Unlike GHS or recovery peptides, there is no shared “pumps, sleep, joints” feel map — discussion is disease-status / lab-marker oriented when it is serious at all. forum
  • Acute reports: Legacy accounts describe injection-site sting, warmth, redness or nonspecific fatigue with uncertain product, vehicle and causality. One author planned 12 weeks without known cancer and reported 500 mcg nightly, possible early dizziness/fatigue and restorative sleep, then judged early effects likely placebo around three weeks; a later reply reported 1 mg nightly, normal bloodwork and no adverse events. Their route was not stated. A different user reported large itchy swelling after changing both amount and vial. A caregiver described no success with SubQ/nasal use amid dexamethasone and other peptides; another oncology report described no tumor change after four weeks and low blood counts delaying radiation. These are unverified personal reports, not causal or safety findings. anecdote
  • Days 1–7: Wellness logs are rare; flu-like nonspecifics and site irritation dominate what little subjective chatter exists. Expectation bias is extreme in alt-cancer forums. forum
  • Weeks 1–4: Threads that exist lean toward “any scan/labs yet?” rather than day-by-day energy scores; absence of early subjective “win” is common and not diagnostic. forum
  • Multi-week marketing courses: Secondary sites describe multi-week daily IV- or SC-style regimens — these are not transparent human PK series and often omit identity/sterility proof. forum
  • If nothing changes: Escalating a research chemical while delaying standard oncology care is the main harm path discussed by regulators and clinicians — not a cue to self-escalate dose. forum
  • After stop: No consensus “rebound” or washout feel; disease biology and concurrent treatments dominate outcomes. forum
  • Lab PD speed: Membrane lysis can register in minutes–hours once peptide meets membrane HDM-2 in culture; that is not a human “you will feel better by day 3” claim. lab

Cycles people discuss 8

  • Vendor multi-week courses: Secondary SC charts describe ~8–16 week once-daily ladders; these are marketing/education constructs, not SOC oncology. forum
  • IV multi-week marketing: Historical product sites and secondary summaries described multi-week daily IV-style use — not transparent trial registries. forum
  • Open-ended consumer use: Poorly logged; risk rises if it replaces or delays evidence-based oncology. forum
  • Time off / cruise: No consensus “cruise dose.” Oncology logic is reassess disease status (imaging, markers, clinical exam), not a peptide calendar. forum
  • Re-challenge talk: Sparse; if anything, people discuss new vials/courses after progression anxiety — still anecdote-level. anecdote
  • Not a bodybuilding cycle: Preclinical framing is days–weeks of continuous or daily exposure against tumor burden, not 8-on/4-off aesthetic cycles. forum
  • Mouse AML course length: Daily IP for ~2–3 weeks is a published-style block; survival was followed well beyond the dosing window in secondary-transplant designs. animal
  • Pump delivery window: ~14-day continuous osmotic delivery is a recurring solid-tumor experimental pattern for PNC-27/28-class work. animal

Timing 7

  • Half-life poorly established: Secondary peptide pages often quote ~30 minutes; other education sites estimate ~2–4 hours from “preclinical-style” guesses — robust human PK is not published as a package. forum
  • Clearance logic: Assumed rapid peptidase / renal-hepatic peptide breakdown; used rhetorically to justify frequent (daily or continuous-pump) experimental dosing. forum
  • Route > clock: IV vs IP vs intratumoral vs SC vs mucosal dominates exposure logic more than “AM vs PM” performance timing. Morning SC habit talk on vendor sites is convenience only. forum
  • Half-life extension ideas (patent/discussion): D-amino acid on the N-terminus and/or leupeptin-type peptidase-inhibitor attachments have been discussed in patent literature to slow breakdown of PNC-27/28-class peptides — research design notes, not consumer products. trial
  • PD vs PK: Pharmacodynamic story is fast pore necrosis on HDM-2 engagement (minutes–hours in vitro), not long receptor agonism or genomic reprogramming over days. trial
  • Intact peptide: Work arguing PNC-27 kills as the intact peptide (not only after proteolytic fragments) supports a membrane-complex model rather than a prodrug-fragment story. trial
  • In-vitro kill clocks: Co-localization with membrane HDM-2 reported within ~15 minutes at ~50 μg/mL in some lines; pores visible on EM within minutes; high LDH kill by ~90 min–4 h common. lab

More on what it is 9

  • Developer lineage: Pincus / SUNY Downstate–associated literature; Oncolyze discusses OM-301 as a 32-aa lead built on this HDM-2 surface-pore concept (previously referred to in company materials as PNC-27 lineage), with AML as a lead indication interest and Phase 1/2 aspirational — not an approved product. forum
  • Not approved: Not an FDA-approved cancer drug. In 2017 the FDA warned consumers not to buy/use PNC-27 products marketed as a treatment or cure for cancer after lab detection of *Variovorax paradoxus* in a sample. forum
  • Not: Not a recovery/joint peptide like BPC-157, not an immune “tonic” like TA-1 for general wellness, and not interchangeable with intracellular MDM2–p53 small-molecule drugs. forum
  • What it is: Synthetic ~32-residue chimeric peptide: p53 HDM-2-binding segment (residues 12–26, PPLSQETFSDLWKLL) fused at the C-terminus to a membrane residency peptide / penetratin-style leader (KKWKMRRNQFWVKVQRG from Antennapedia). Full one-letter string commonly listed: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG. trial
  • Catalog identity: Lab suppliers list CAS 1159861-00-3, formula C188H293N53O44S, MW ~4031.7 Da — always cross-check COA/sequence, not just the name on a vial. trial
  • Mechanism (core story): Binds membrane-associated HDM-2 on many cancer cells → PNC-27–HDM-2 complexes line transmembrane pores → osmotic lysis / necrotic death (LDH release), often called membranolysis or vendor “pop-tosis,” not classic apoptosis-first killing. trial
  • p53-independence: Pore necrosis is reported in p53-null models (e.g., K562), so activity is not framed as restoring nuclear p53 transcription the way some MDM2 small-molecule inhibitors are sold. trial
  • Selectivity claim: Parallel assays often show high kill on cancer lines / primary tumor cells with little effect on untransformed fibroblasts, acinar cells, keratinocytes, breast epithelium, HUVEC, or normal hematopoietic stem-cell differentiation under growth factors — still model-limited, not human safety proof. lab
  • Evidence honesty: Strong preclinical cell/animal literature; large modern human RCTs and robust human PK packages are not established. Secondary wellness and student essays sometimes claim “successful clinical trials” or “use outside the US” — treat those as overstated relative to the peer-reviewed base. trial

Stacks 10

  • Not a recovery stack: Rarely paired for joints/gut the way BPC-157 + TB-500 are; oncology-adjacent, not athletic. forum
  • Immune peptides (forum talk): Occasional co-mention with Thymosin Alpha-1 or other “immune” research peptides in alt-cancer threads — confounded polypharmacy, no validated synergy package. forum
  • Membrane-active contrasts: LL-37 and melittin-class peptides appear in compare lists as pore-formers with different selectivity stories — not recommended co-injections. forum
  • Avoid “cure stacks”: Multi-agent alt-cancer marketing (nebulized + IV + oral kits, etc.) conflicts with standard-of-care guidance and multiplies contamination/interaction unknowns. forum
  • Chemo / immuno concurrent: Unknown human DDI tables; any concurrent oncology drugs make anecdote attribution unreliable and require oncology supervision in real care settings. forum
  • Antioxidant megadose lore: Rare theoretical chatter that high-dose antioxidants might blunt oxidative aspects of cell death — speculative, not a defined interaction study for PNC-27. forum
  • PNC-28: Main literature companion/compare peptide (shorter HDM-2 contact segment + same penetratin). Using both is generally called redundant in education-site stack notes. trial
  • PNC-29 control: Unrelated cytochrome-P450 fragment + penetratin used as inactive control in papers — not a stack partner. trial
  • Paclitaxel combinations (research): Ovarian-cancer lab work has explored PNC-27 with or after paclitaxel, including cells surviving taxane exposure — controlled experimental design, not a DIY chemo stack. lab
  • Acetoacetate / Li-acetoacetate (lab): In-vitro sensitization of some cervical/breast-context lines reported; social posts sometimes misread this as a ketone diet protocol. lab

Storage notes 2

  • No mix instructions here: STUDresearch does not list reconstitution, diluent volumes, or syringe unit charts. People reconstitute many different ways and vial labels differ — that content creates more confusion than clarity. forum
  • Storage (general talk only): Unopened research products are usually kept cool, dry, and away from light per the seller label. Anything after first use is product-specific — follow the label, not a universal forum SOP. forum

Watch for 13

  • FDA warning (2017): Do not buy or use PNC-27 products sold as a treatment or cure for cancer — not FDA-approved; agency lab found *Variovorax paradoxus* bacteria in a tested sample (including inhalable-form context in news coverage). forum
  • Infection risk: Contaminated unapproved multi-route products can cause serious, potentially life-threatening infections; higher risk groups called out in FDA-era coverage include young children, elderly, pregnant people, and immunocompromised patients. forum
  • Injection-site reactions: Local irritation, redness, warmth, tenderness, or discomfort with parenteral/intratumoral talk — common peptide hygiene issues plus unknown product quality. anecdote
  • Systemic nonspecifics: Fatigue, mild flu-like feelings, low-grade fever, or headache appear in sparse experimental/anecdotal write-ups — causality and product identity often unclear. anecdote
  • Allergy / anaphylaxis class risk: Any peptide can theoretically trigger hypersensitivity; emergency care for hives, swelling, or breathing difficulty is standard caution language. forum
  • Delay of care: Replacing evidence-based oncology with research-chemical or gray-market “cure” products is the central harm pathway emphasized by regulators and clinicians. forum
  • Unknown human DDI: No solid human drug–drug interaction tables vs chemo, targeted agents, anticoagulants, immunosuppressants, or other injectables. forum
  • Source quality: Identity, sterility, endotoxin, and dose accuracy of research vials are structural risks; “research use only” labels do not equal pharmacy compounding standards. forum
  • Route-specific risks: Nebulized/mucosal products add airway and mucosal infection/absorption unknowns; IV adds systemic infection and infusion risks; IT adds local tissue injury risks. forum
  • Overstated trial claims: Be skeptical of blogs or student papers asserting completed successful human trials or foreign “current use as cure” without primary trial registration and peer-reviewed human endpoints. forum
  • WADA / sport: Unapproved substance class concerns appear on some protocol pages for athletes — secondary listing, not the main user base. forum
  • Pregnancy / lactation: No adequate human reproductive safety package; education sites list as avoid. forum
  • Selectivity ≠ safety: Lab cancer-vs-normal sparing and mouse off-target claims do not prove safe multi-route human self-administration, pregnancy safety, or long-term organ safety. trial

Updated: 2026-08-12

Evidence mix Mixed trial + community tags Full: every bullet (trial + community). Use Scan for a faster bro-science read.

All STUDresearch topics →